PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_02799.1_g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 290aa    MW: 31545.3 Da    PI: 8.4904
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_02799.1_g00002.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.33.5e-181358147
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                             +g+W++eEdell  +v+++G+++W++I++ +  gR++k+c++rw + 
  Rsa1.0_02799.1_g00002.1 13 KGPWSPEEDELLQTLVQKHGPRNWSLISKPIS-GRSGKSCRLRWCNQ 58
                             79******************************.***********985 PP

2Myb_DNA-binding52.61e-1667109347
                              SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              +++ eEde +++a++++G++ W+tIar ++ gRt++ +k++w++ 
  Rsa1.0_02799.1_g00002.1  67 SFSLEEDETILHAHARFGNK-WATIARLLN-GRTDNAIKNHWNST 109
                              6999****************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.31863IPR017930Myb domain
SuperFamilySSF466893.38E-3110106IPR009057Homeodomain-like
SMARTSM007172.9E-151261IPR001005SANT/Myb domain
PfamPF002491.2E-171358IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-241466IPR009057Homeodomain-like
CDDcd001675.73E-141557No hitNo description
SMARTSM007171.2E-1364112IPR001005SANT/Myb domain
PROSITE profilePS5129419.77465114IPR017930Myb domain
PfamPF002493.7E-1467109IPR001005SANT/Myb domain
CDDcd001673.22E-1067110No hitNo description
Gene3DG3DSA:1.10.10.609.5E-2267113IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 290 aa     Download sequence    Send to blast
MSGSTRKETD RIKGPWSPEE DELLQTLVQK HGPRNWSLIS KPISGRSGKS CRLRWCNQLS  60
PEVEHRSFSL EEDETILHAH ARFGNKWATI ARLLNGRTDN AIKNHWNSTL KRKCRGGGWT  120
SDDGGNGGYD GNLTDEQPLK RTASGGGGGV VSTGLFMNPG SPSGSNVSEQ SSGTVLHVYK  180
PTARPGAVVI ESTVKDPVTS LSLSLPCVNE STQRKDTAEL FPVRKQEEER ERFNGDFMTV  240
VQEMIKTEVR SYMAGLQLGN GGGGSGSCVV QGVNGPSVGF RNFIEIVKIE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C8e-41121143105C-Myb DNA-Binding Domain
1mse_C8e-41121143105C-Myb DNA-Binding Domain
1gv2_A9e-41121143105MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013746967.11e-173PREDICTED: transcription factor MYB44
SwissprotQ9FDW13e-91MYB44_ARATH; Transcription factor MYB44
TrEMBLA0A078HQ861e-171A0A078HQ86_BRANA; BnaA04g13540D protein
STRINGBra032176.1-P1e-168(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM67728135
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37260.11e-109myb domain protein 73